Recombinant Human selectin P ligand Protein, His tagged
Cat.No. : | SELPLG-001H |
Product Overview : | Recombinant human selectin P ligand Protein (44-295 aa) with His tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 44-295aa |
Description : | This gene encodes a glycoprotein that functions as a high affinity counter-receptor for the cell adhesion molecules P-, E- and L- selectin expressed on myeloid cells and stimulated T lymphocytes. As such, this protein plays a critical role in leukocyte trafficking during inflammation by tethering of leukocytes to activated platelets or endothelia expressing selectins. This protein requires two post-translational modifications, tyrosine sulfation and the addition of the sialyl Lewis x tetrasaccharide (sLex) to its O-linked glycans, for its high-affinity binding activity. Aberrant expression of this gene and polymorphisms in this gene are associated with defects in the innate and adaptive immune response. Alternate splicing results in multiple transcript variants. |
Tag : | C-His |
Molecular Mass : | 27 kDa |
AA Sequence : | TEYEYLDYDFLPETEPPEMLRNSTDTTPLTGPGTPESTTVEPAARRSTGLDAGGAVTELTTELANMGNLSTDSAAMEIQTTQPAATEAQTTQPVPTEAQTTPLAATEAQTTRLTATEAQTTPLAATEAQTTPPAATEAQTTQPTGLEAQTTAPAAMEAQTTAPAAMEAQTTPPAAMEAQTTQTTAMEAQTTAPEATEAQTTQPTATEAQTTPLAAMEALSTEPSATEALSMEPTTKRGLFIPFSVSSVTHKGHHHHHHHH |
Endotoxin : | < 1 EU/μg of protein (determined by LAL method) |
Purity : | > 85% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Sterile PBS, pH 7.4 |
Concentration : | 1 mg/mL by BCA |
Gene Name | SELPLG selectin P ligand [ Homo sapiens (human) ] |
Official Symbol | SELPLG |
Synonyms | SELPLG; selectin P ligand; P-selectin glycoprotein ligand 1; CD162; PSGL 1; cutaneous lymphocyte-associated associated antigen; CLA; PSGL1; PSGL-1; |
Gene ID | 6404 |
mRNA Refseq | NM_001206609 |
Protein Refseq | NP_001193538 |
MIM | 600738 |
UniProt ID | Q14242 |
◆ Recombinant Proteins | ||
SELPLG-433H | Recombinant Human selectin P ligand, His-tagged | +Inquiry |
SELPLG-2049H | Recombinant Human SELPLG Protein, His-tagged | +Inquiry |
Selplg-5700R | Recombinant Rat Selplg protein, His & T7-tagged | +Inquiry |
SELPLG-531H | Recombinant Human SELPLG Protein, Fc-tagged | +Inquiry |
SELPLG-560H | Recombinant Human SELPLG Protein (Leu18-Cys320), C-6×His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SELPLG-001MCL | Recombinant Mouse SELPLG cell lysate | +Inquiry |
SELPLG-1089HCL | Recombinant Human SELPLG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SELPLG Products
Required fields are marked with *
My Review for All SELPLG Products
Required fields are marked with *
0
Inquiry Basket