Recombinant Human SEC61G Full Length protein, GST-tagged
Cat.No. : | SEC61G-2568H |
Product Overview : | Recombinant Human Full Length SEC61G protein(1-68 aa), fused with N-terminal GST tag, was expressed in E. coli. |
Availability | April 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | N-GST |
Protein Length : | 1-68 aa |
Tag : | N-GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIPINNIIVGG |
Gene Name | SEC61G Sec61 gamma subunit [ Homo sapiens ] |
Official Symbol | SEC61G |
Synonyms | SEC61G; Sec61 gamma subunit; protein transport protein Sec61 subunit gamma; SSS1; protein transport protein SEC61 gamma subunit |
Gene ID | 23480 |
mRNA Refseq | NM_001012456 |
Protein Refseq | NP_001012474 |
MIM | 609215 |
UniProt ID | P60059 |
◆ Recombinant Proteins | ||
SEC61G-5658C | Recombinant Chicken SEC61G | +Inquiry |
SEC61G-14841M | Recombinant Mouse SEC61G Protein | +Inquiry |
RFL27152MF | Recombinant Full Length Mouse Protein Transport Protein Sec61 Subunit Gamma(Sec61G) Protein, His-Tagged | +Inquiry |
SEC61G-627Z | Recombinant Zebrafish SEC61G | +Inquiry |
SEC61G-3946R | Recombinant Rhesus Macaque SEC61G Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SEC61G-1989HCL | Recombinant Human SEC61G 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SEC61G Products
Required fields are marked with *
My Review for All SEC61G Products
Required fields are marked with *
0
Inquiry Basket