Recombinant Human SEC22A Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SEC22A-2354H
• Product Overview: SEC22A MS Standard C13 and N15-labeled recombinant protein (NP_036562) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: The protein encoded by this gene belongs to the member of the SEC22 family of vesicle trafficking proteins. This protein has similarity to rat SEC22 and may act in the early stages of the secretory pathway.
• Molecular Mass: 34.9 kDa
• AA Sequence: MSMILSASVIRVRDGLPLSASTDYEQSTGMQECRKYFKMLSRKLAQLPDRCTLKTGHYNINFISSLGVSYMMLCTENYPNVLAFSFLDELQKEFITTYNMMKTNTAVRPYCFIEFDNFIQRTKQRYNNPRSLSTKINLSDMQTEIKLRPPYQISMCELGSANGVTSAFSVDCKGAGKISSAHQRLEPATLSGIVGFILSLLCGALNLIRGFHAIESLLQSDGDDFNYIIAFFLGTAACLYQCYLLVYYTGWRNVKSFLTFGLICLCNMYLYELRNLWQLFFHVTVGAFVTLQIWLRQAQGKAPDYDVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SEC22A SEC22 homolog A, vesicle trafficking protein [ Homo sapiens (human) ]
• Official Symbol: SEC22A
• Synonyms: SEC22A; SEC22 vesicle trafficking protein homolog A (S. cerevisiae); SEC22 vesicle trafficking protein like 2 (S. cerevisiae), SEC22L2; vesicle-trafficking protein SEC22a; sec22 homolog; SEC22 vesicle trafficking protein-like 2; SEC22 vesicle-trafficking protein-like 2; SEC22 vesicle-trafficking protein homolog A; SEC22L2
• Gene ID: 26984
• mRNA Refseq: NM_012430
• Protein Refseq: NP_036562
• MIM: 612442
• UniProt ID: Q96IW7