Recombinant Human SEC16A Protein (1943-2154 aa), His-tagged

• Cat.No.: SEC16A-799H
• Product Overview: Recombinant Human SEC16A Protein (1943-2154 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Transport. Protein Description: Partial.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1943-2154 aa
• Description: Defines endoplasmic reticulum exit sites (ERES) and is required for secretory cargo traffic from the endoplasmic reticulum to the Golgi apparatus. SAR1A-GTP-dependent assbly of SEC16A on the ER mbrane forms an organized scaffold defining an ERES. Required for normal transitional endoplasmic reticulum (tER) organization.
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 26.1 kDa
• AA Sequence: AYLPDDKNKSIVWDEKKNQWVNLNEPEEEKKAPPPPPTSMPKTVQAAPPALPGPPGAPVNMYSRRAAGTRARYVDVLNPSGTQRSEPALAPADFVAPLAPLPIPSNLFVPTPDAEEPQLPDGTGREGPAAARGLANPEPAPEPKVLSSAASLPGSELPSSRPEGSQGGELSRCSSMSSLSREVSQHFNQAPGDLPAAGGPPSGAMPFYNPAQ
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: SEC16A SEC16 homolog A (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: SEC16A
• Synonyms: SEC16A; KIAA0310; p250; SEC16L; FLJ26737; RP11-413M3.10
• Gene ID: 9919
• mRNA Refseq: NM_014866
• Protein Refseq: NP_055681
• MIM: 612854
• UniProt ID: O15027