Recombinant Human SEC13 protein, GST-tagged

• Cat.No.: SEC13-3774H
• Product Overview: Recombinant Human SEC13 protein(1-325 aa), fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-325 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• AA Sequence: MGKMVSVINTVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQILIADLRGHEGPVWQVAWAHPMYGNILASCSYDRKVIIWREENGTWEKSHEHAGHDSSVNSVCWAPHDYGLILACGSSDGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLIDHPSGQKPNYIKRFASGGCDNLIKLWKEEEDGQWKEEQKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASSNTWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQWVCISDVNKGQGSVSASVTEGQQNEQ
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: SEC13 SEC13 homolog (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: SEC13
• Synonyms: SEC13; SEC13 homolog (S. cerevisiae); D3S1231E, SEC13 (S. cerevisiae) like 1 , SEC13 like 1 (S. cerevisiae) , SEC13L1; protein SEC13 homolog; npp 20; SEC13R; SEC13-like 1 isoform; SEC13-like protein 1; SEC13-related protein; npp-20; SEC13L1; D3S1231E
• Gene ID: 6396
• mRNA Refseq: NM_001136232
• Protein Refseq: NP_001129704
• MIM: 600152
• UniProt ID: P55735