Recombinant Human SDHAF4 Protein, GST-Tagged

• Cat.No.: SDHAF4-0125H
• Product Overview: Human SDHAF4 full-length ORF (NP_660310.2, 1 a.a. - 108 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: SDHAF4 (Succinate Dehydrogenase Complex Assembly Factor 4) is a Protein Coding gene.
• Molecular Mass: 38.28 kDa
• AA Sequence: MTPSRLPWLLSWVSATAWRAARSPLLCHSLRKTSSSQGGKSELVKQSLKKPMLPEGRFDAPEDSHLEKEPLEKFPDDVNPVTKEKGGPRGPEPTRYGDWERKGRCIDF
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: SDHAF4 succinate dehydrogenase complex assembly factor 4 [ Homo sapiens (human) ]
• Official Symbol: SDHAF4
• Synonyms: SDHAF4; succinate dehydrogenase complex assembly factor 4; Sdh8; C6orf57; Succinate Dehydrogenase Complex Assembly Factor 4; SDH Assembly Factor 4; Succinate Dehydrogenase Assembly Factor 4, Mitochondrial; Chromosome 6 Open Reading Frame 57; UPF0369 Protein C6orf57
• Gene ID: 135154
• mRNA Refseq: NM_145267
• Protein Refseq: NP_660310
• UniProt ID: Q5VUM1