Recombinant Human SDHAF4 Protein, GST-Tagged

Cat.No. : SDHAF4-0125H
Product Overview : Human SDHAF4 full-length ORF (NP_660310.2, 1 a.a. - 108 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : SDHAF4 (Succinate Dehydrogenase Complex Assembly Factor 4) is a Protein Coding gene.
Molecular Mass : 38.28 kDa
AA Sequence : MTPSRLPWLLSWVSATAWRAARSPLLCHSLRKTSSSQGGKSELVKQSLKKPMLPEGRFDAPEDSHLEKEPLEKFPDDVNPVTKEKGGPRGPEPTRYGDWERKGRCIDF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name SDHAF4 succinate dehydrogenase complex assembly factor 4 [ Homo sapiens (human) ]
Official Symbol SDHAF4
Synonyms SDHAF4; succinate dehydrogenase complex assembly factor 4; Sdh8; C6orf57; Succinate Dehydrogenase Complex Assembly Factor 4; SDH Assembly Factor 4; Succinate Dehydrogenase Assembly Factor 4, Mitochondrial; Chromosome 6 Open Reading Frame 57; UPF0369 Protein C6orf57
Gene ID 135154
mRNA Refseq NM_145267
Protein Refseq NP_660310
UniProt ID Q5VUM1

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SDHAF4 Products

Required fields are marked with *

My Review for All SDHAF4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon