Recombinant Human SDHAF3 Protein, GST-Tagged

• Cat.No.: SDHAF3-162H
• Product Overview: Human ACN9 full-length ORF (AAH20621.1, 1 a.a. - 125 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: SDHAF3 (Succinate Dehydrogenase Complex Assembly Factor 3) is a Protein Coding gene.
• Molecular Mass: 40.15 kDa
• AA Sequence: MPGRHVSRVRALYKRVLQLHRVLPPDLKSLGDQYVKDEFRRHKTVGSDEAQRFLQEWEVYATALLQQANENRQNSTGKACFGTFLPEEKLNDFRDEQIGQLQELMQEATKPNRQFSISESMKPKF
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: SDHAF3 succinate dehydrogenase complex assembly factor 3 [ Homo sapiens (human) ]
• Official Symbol: SDHAF3
• Synonyms: SDHAF3; succinate dehydrogenase complex assembly factor 3; Succinate Dehydrogenase Complex Assembly Factor 3; SDH Assembly Factor 3; ACN9; Succinate Dehydrogenase Assembly Factor 3, Mitochondrial; Protein ACN9 Homolog, Mitochondrial; ACN9 Homolog (S. Cerevisiae); ACN9 Homolog; LYRM10; DC11; Sdh7; succinate dehydrogenase assembly factor 3, mitochondrial; SDH assembly factor 3; protein ACN9 homolog, mitochondrial
• Gene ID: 57001
• mRNA Refseq: NM_020186
• Protein Refseq: NP_064571
• MIM: 615773
• UniProt ID: Q9NRP4