Recombinant Human SDHA Protein, GST-tagged
Cat.No. : | SDHA-1367H |
Product Overview : | Recombinant Human SDHA Protein (44-293aa) was expressed in E. coli with N-terminal GST tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 44-293 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 54.1 kDa |
AA Sequence : | SAKVSDSISAQYPVVDHEFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGN MEEDNWRWHFYDTVKGSDWLGDQDAIHYMTEQAPAAVVELENYGMPFSRTEDGKIYQRAFGGQSLKFGKG GQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIALCIEDGSIHRIRAKNTV VATGGYGRTYFSCTSAHTSTGDGTAMITRAGLPCQDLEFV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | SDHA succinate dehydrogenase complex flavoprotein subunit A [ Homo sapiens (human) ] |
Official Symbol | SDHA |
Synonyms | FP; PGL5; SDH1; SDH2; SDHF; CMD1GG |
Gene ID | 6389 |
mRNA Refseq | NM_004168.3 |
Protein Refseq | NP_004159.2 |
MIM | 600857 |
UniProt ID | P31040 |
◆ Recombinant Proteins | ||
SDHA-0314B | Recombinant Bacillus subtilis SDHA protein, His-tagged | +Inquiry |
SDHA-1367H | Recombinant Human SDHA Protein, GST-tagged | +Inquiry |
SDHA-14801M | Recombinant Mouse SDHA Protein | +Inquiry |
SDHA-3476H | Recombinant Human SDHA protein, His-tagged | +Inquiry |
SDHA-11152Z | Recombinant Zebrafish SDHA | +Inquiry |
◆ Cell & Tissue Lysates | ||
SDHA-2011HCL | Recombinant Human SDHA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SDHA Products
Required fields are marked with *
My Review for All SDHA Products
Required fields are marked with *
0
Inquiry Basket