Recombinant Human SDCBP Protein, His-tagged

• Cat.No.: SDCBP-698H
• Product Overview: Recombinant Human SDCBP, transcript variant 5, fused with His tag at C-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: The protein encoded by this gene was initially identified as a molecule linking syndecan-mediated signaling to the cytoskeleton. The syntenin protein contains tandemly repeated PDZ domains that bind the cytoplasmic, C-terminal domains of a variety of transmembrane proteins. This protein may also affect cytoskeletal-membrane organization, cell adhesion, protein trafficking, and the activation of transcription factors. The protein is primarily localized to membrane-associated adherens junctions and focal adhesions but is also found at the endoplasmic reticulum and nucleus. Alternative splicing results in multiple transcript variants encoding different isoforms. Related pseudogenes have been identified on multiple chromosomes.
• Form: Supplied as a 0.2 µm filtered solution of PBS, pH 7.4
• Molecular Mass: 33kD
• AA Sequence: SLYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGQLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIAD
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining

Gene Information

• Gene Name: SDCBP syndecan binding protein (syntenin) [ Homo sapiens ]
• Official Symbol: SDCBP
• Synonyms: SDCBP; syndecan binding protein (syntenin); syntenin-1; SYCL; scaffold protein Pbp1; syndecan-binding protein 1; melanoma differentiation associated protein-9; melanoma differentiation-associated protein 9; pro-TGF-alpha cytoplasmic domain-interacting protein 18; ST1; MDA-9; TACIP18
• Gene ID: 6386
• mRNA Refseq: NM_001007067
• Protein Refseq: NP_001007068
• MIM: 602217
• UniProt ID: O00560