Recombinant Human SCN9A protein, GST-tagged
Cat.No. : | SCN9A-27560TH |
Product Overview : | Recombinant Human SCN9A(269 a.a. - 339 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
Availability | March 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 269-339 a.a. |
Description : | This gene encodes a voltage-gated sodium channel which plays a significant role in nociception signaling. Mutations in this gene have been associated with primary erythermalgia, channelopathy-associated insensitivity to pain, and paroxysmal extreme pain disorder. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 33.55 kDa |
AA Sequence : | GNLKHKCFRNSLENNETLESIMNTLESEEDFRKYFYYLEGSKDALLCGFSTDSGQCPEGYTCVKIGRNPDY |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | SCN9A sodium channel, voltage-gated, type IX, alpha subunit [ Homo sapiens ] |
Official Symbol | SCN9A |
Synonyms | SCN9A; sodium channel, voltage-gated, type IX, alpha subunit; sodium channel, voltage gated, type IX, alpha polypeptide; sodium channel protein type 9 subunit alpha; ETHA; Nav1.7; NE NA; NENA; PN1; hNE-Na; peripheral sodium channel 1; neuroendocrine sodium channel; sodium channel protein type IX subunit alpha; voltage-gated sodium channel alpha subunit Nav1.7; voltage-gated sodium channel subunit alpha Nav1.7; sodium channel, voltage-gated, type IX, alpha polypeptide; SFNP; FEB3B; NE-NA; GEFSP7; |
Gene ID | 6335 |
mRNA Refseq | NM_002977 |
Protein Refseq | NP_002968 |
MIM | 603415 |
UniProt ID | Q15858 |
Chromosome Location | 2q24 |
Pathway | Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Interaction between L1 and Ankyrins, organism-specific biosystem; L1CAM interactions, organism-specific biosystem; |
Function | voltage-gated ion channel activity; voltage-gated sodium channel activity; |
◆ Recombinant Proteins | ||
SCN9A-4929R | Recombinant Rat SCN9A Protein, His (Fc)-Avi-tagged | +Inquiry |
SCN9A-5570C | Recombinant Chicken SCN9A | +Inquiry |
SCN9A-5270R | Recombinant Rat SCN9A Protein | +Inquiry |
SCN9A-27560TH | Recombinant Human SCN9A protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SCN9A Products
Required fields are marked with *
My Review for All SCN9A Products
Required fields are marked with *
0
Inquiry Basket