Recombinant Human SCN1B Protein, GST-tagged
Cat.No. : | SCN1B-48H |
Product Overview : | Human SCN1B full-length ORF ( NP_001028.1, 1 a.a. - 218 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Voltage-gated sodium channels are heteromeric proteins that function in the generation and propagation of action potentials in muscle and neuronal cells. They are composed of one alpha and two beta subunits, where the alpha subunit provides channel activity and the beta-1 subunit modulates the kinetics of channel inactivation. This gene encodes a sodium channel beta-1 subunit. Mutations in this gene result in generalized epilepsy with febrile seizures plus, Brugada syndrome 5, and defects in cardiac conduction. Multiple transcript variants encoding different isoforms have been found for this gene. |
Molecular Mass : | 49.61 kDa |
AA Sequence : | MGRLLALVVGAALVSSACGGCVEVDSETEAVYGMTFKILCISCKRRSETNAETFTEWTFRQKGTEEFVKILRYENEVLQLEEDERFEGRVVWNGSRGTKDLQDLSIFITNVTYNHSGDYECHVYRLLFFENYEHNTSVVKKIHIEVVDKANRDMASIVSEIMMYVLIVVLTIWLVAEMIYCYKKIAAATETAAQENASEYLAITSESKENCTGVQVAE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | SCN1B sodium voltage-gated channel beta subunit 1 [ Homo sapiens (human) ] |
Official Symbol | SCN1B |
Synonyms | ATFB13; BRGDA5; EIEE52; GEFSP1; |
Gene ID | 6324 |
mRNA Refseq | NM_001037 |
Protein Refseq | NP_001028 |
MIM | 600235 |
UniProt ID | Q07699 |
◆ Recombinant Proteins | ||
SCN1B-2535H | Recombinant Human SCN1B, GST-tagged | +Inquiry |
SCN1B-3916R | Recombinant Rhesus Macaque SCN1B Protein, His (Fc)-Avi-tagged | +Inquiry |
SCN1B-14754M | Recombinant Mouse SCN1B Protein | +Inquiry |
RFL9555MF | Recombinant Full Length Mouse Sodium Channel Subunit Beta-1(Scn1B) Protein, His-Tagged | +Inquiry |
SCN1B-7938M | Recombinant Mouse SCN1B Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SCN1B-2031HCL | Recombinant Human SCN1B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SCN1B Products
Required fields are marked with *
My Review for All SCN1B Products
Required fields are marked with *
0
Inquiry Basket