Recombinant Human SCN11A protein, His-tagged

Cat.No. : SCN11A-3910H
Product Overview : Recombinant Human SCN11A protein(812-1051 aa), fused to His tag, was expressed in E. coli.
Availability April 27, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 812-1051 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : NSFSNEERNGNLEGEARKTKVQLALDRFRRAFCFVRHTLEHFCHKWCRKQNLPQQKEVAGGCAAQSKDIIPLVMEMKRGSETQEELGILTSVPKTLGVRHDWTWLAPLAEEEDDVEFSGEDNAQRITQPEPEQQAYELHQENKKPTSQRVQSVEIDMFSEDEPHLTIQDPRKKSDVTSILSECSTIDLQDGFGWLPEMVPKKQPERCLPKGFGCCFPCCSVDKRKPPWVIWWNLRKTCYQ
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name SCN11A sodium channel, voltage-gated, type XI, alpha subunit [ Homo sapiens ]
Official Symbol SCN11A
Synonyms SCN11A; sodium channel, voltage-gated, type XI, alpha subunit; SCN12A, sodium channel, voltage gated, type XI, alpha polypeptide , sodium channel, voltage gated, type XII, alpha; sodium channel protein type 11 subunit alpha; NaN; Nav1.9; SNS 2; PN5; hNaN; sensory neuron sodium channel 2; peripheral nerve sodium channel 5; voltage-gated sodium channel Nav1.9; sodium channel protein type XI subunit alpha; voltage-gated sodium channel subunit alpha Nav1.9; sodium channel, voltage-gated, type XI, alpha polypeptide; sodium channel, voltage-gated, type XII, alpha polypeptide; SNS-2; NAV1.9; SCN12A;
Gene ID 11280
mRNA Refseq NM_014139
Protein Refseq NP_054858
MIM 604385
UniProt ID Q9UI33

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SCN11A Products

Required fields are marked with *

My Review for All SCN11A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon