Recombinant Human SCML1 protein, T7/His-tagged

Cat.No. : SCML1-215H
Product Overview : Recombinant human SCML1 cDNA (2 – 302aa, Isoform-B, which derived from BC026159) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Protein Length : 2-302 a.a.
Form : 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence : MASMTGGQQMGRGHHHHHHENLYFQGEFMSNSSSEIDVQEPNIVSDASCNTEEQLKTVDDVLIHCQVIYDALQNL DKKIDVIRRKVSKIQRFHARSLWTNHKRYGYKKHSYRLVKKLKLQKMKKNEVYETFSYPESYSPTLPVSRRENNS PSNLPRPSFCMEEYQRAELEEDPILSRTPSPVHPSDFSEHNCQPYYASDGATYGSSSGLCLGNPRADSIHNTYST DHASAAPPSVTRSPVENDGYIEEGSITKHPSTWSVEAVVLFLKQTDPLALCPLVDLFRSHEIDGKALLLLTSDVL LKHLGVKLGTAVKLCYYIDRLKQGKCFEN
Purity : >90% by SDS-PAGE
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name SCML1 sex comb on midleg-like 1 (Drosophila) [ Homo sapiens ]
Official Symbol SCML1
Synonyms SCML1; sex comb on midleg-like 1 (Drosophila); sex comb on midleg (Drosophila) like 1; sex comb on midleg-like protein 1;
Gene ID 6322
mRNA Refseq NM_001037535
Protein Refseq NP_001032624
MIM 300227
UniProt ID Q9UN30
Chromosome Location Xp22
Function DNA binding; sequence-specific DNA binding transcription factor activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SCML1 Products

Required fields are marked with *

My Review for All SCML1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon