Recombinant Human SCML1 protein, T7/His-tagged
Cat.No. : | SCML1-215H |
Product Overview : | Recombinant human SCML1 cDNA (2 – 302aa, Isoform-B, which derived from BC026159) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 2-302 a.a. |
Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGEFMSNSSSEIDVQEPNIVSDASCNTEEQLKTVDDVLIHCQVIYDALQNL DKKIDVIRRKVSKIQRFHARSLWTNHKRYGYKKHSYRLVKKLKLQKMKKNEVYETFSYPESYSPTLPVSRRENNS PSNLPRPSFCMEEYQRAELEEDPILSRTPSPVHPSDFSEHNCQPYYASDGATYGSSSGLCLGNPRADSIHNTYST DHASAAPPSVTRSPVENDGYIEEGSITKHPSTWSVEAVVLFLKQTDPLALCPLVDLFRSHEIDGKALLLLTSDVL LKHLGVKLGTAVKLCYYIDRLKQGKCFEN |
Purity : | >90% by SDS-PAGE |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | SCML1 sex comb on midleg-like 1 (Drosophila) [ Homo sapiens ] |
Official Symbol | SCML1 |
Synonyms | SCML1; sex comb on midleg-like 1 (Drosophila); sex comb on midleg (Drosophila) like 1; sex comb on midleg-like protein 1; |
Gene ID | 6322 |
mRNA Refseq | NM_001037535 |
Protein Refseq | NP_001032624 |
MIM | 300227 |
UniProt ID | Q9UN30 |
Chromosome Location | Xp22 |
Function | DNA binding; sequence-specific DNA binding transcription factor activity; |
◆ Recombinant Proteins | ||
SCML1-4097R | Recombinant Rhesus monkey SCML1 Protein, His-tagged | +Inquiry |
SCML1-2190H | Recombinant Human SCML1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SCML1-4922H | Recombinant Human SCML1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SCML1-215H | Recombinant Human SCML1 protein, T7/His-tagged | +Inquiry |
SCML1-3914R | Recombinant Rhesus Macaque SCML1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SCML1-1569HCL | Recombinant Human SCML1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SCML1 Products
Required fields are marked with *
My Review for All SCML1 Products
Required fields are marked with *
0
Inquiry Basket