Recombinant Human SCGN Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SCGN-6487H
• Product Overview: SCGN MS Standard C13 and N15-labeled recombinant protein (NP_008929) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: The encoded protein is a secreted calcium-binding protein which is found in the cytoplasm. It is related to calbindin D-28K and calretinin. This protein is thought to be involved in KCL-stimulated calcium flux and cell proliferation.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 31.9 kDa
• AA Sequence: MDSSREPTLGRLDAAGFWQVWQRFDADEKGYIEEKELDAFFLHMLMKLGTDDTVMKANLHKVKQQFMTTQDASKDGRIRMKELAGMFLSEDENFLLLFRRENPLDSSVEFMQIWRKYDADSSGFISAAELRNFLRDLFLHHKKAISEAKLEEYTGTMMKIFDRNKDGRLDLNDLARILALQENFLLQFKMDACSTEERKRDFEKIFAYYDVSKTGALEGPEVDGFVKDMMELVQPSISGVDLDKFREILLRHCDVNKDGKIQKSELALCLGLKINPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SCGN secretagogin, EF-hand calcium binding protein [ Homo sapiens (human) ]
• Official Symbol: SCGN
• Synonyms: SCGN; secretagogin, EF-hand calcium binding protein; secretagogin; calbindin like; CALBL; DJ501N12.8; SECRET; SEGN; setagin
• Gene ID: 10590
• mRNA Refseq: NM_006998
• Protein Refseq: NP_008929
• MIM: 609202
• UniProt ID: O76038