Recombinant Human SCGB2A2 protein, His&Myc-tagged

• Cat.No.: SCGB2A2-4424H
• Product Overview: Recombinant Human SCGB2A2 protein(Q13296)(19-93aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli

Specification

• Species: Human
• Source: E.coli
• Tag: His&Myc
• ProteinLength: 19-93aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 37.5 kDa
• AA Sequence: MKLLMVLMLAALSQHCYAGSGCPLLENVISKTINPQVSKTEYKELLQEFIDDNATTNAIDELKECFLNQTDETLSNVEVFMQLIYDSSLCDLF
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: SCGB2A2 secretoglobin, family 2A, member 2 [ Homo sapiens ]
• Official Symbol: SCGB2A2
• Synonyms: SCGB2A2; secretoglobin, family 2A, member 2; mammaglobin 1 , MGB1; mammaglobin-A; mammaglobin A; MGC71974; UGB2; mammaglobin 1; mammaglobin-1; MGB1
• Gene ID: 4250
• mRNA Refseq: NM_002411
• Protein Refseq: NP_002402
• MIM: 605562
• UniProt ID: Q13296