Recombinant Human SCGB2A2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SCGB2A2-854H
Product Overview : SCGB2A2 MS Standard C13 and N15-labeled recombinant protein (NP_002402) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : SCGB2A2 (Secretoglobin Family 2A Member 2) is a Protein Coding gene. Diseases associated with SCGB2A2 include Breast Cancer and Lung Cancer Susceptibility 3. An important paralog of this gene is SCGB2A1.
Molecular Mass : 10.5 kDa
AA Sequence : MKLLMVLMLAALSQHCYAGSGCPLLENVISKTINPQVSKTEYKELLQEFIDDNATTNAIDELKECFLNQTDETLSNVEVFMQLIYDSSLCDLFTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SCGB2A2 secretoglobin family 2A member 2 [ Homo sapiens (human) ]
Official Symbol SCGB2A2
Synonyms SCGB2A2; secretoglobin, family 2A, member 2; mammaglobin 1, MGB1; mammaglobin-A; mammaglobin A; MGC71974; UGB2; mammaglobin 1; mammaglobin-1; MGB1;
Gene ID 4250
mRNA Refseq NM_002411
Protein Refseq NP_002402
MIM 605562
UniProt ID Q13296

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SCGB2A2 Products

Required fields are marked with *

My Review for All SCGB2A2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon