Recombinant Human SCGB2A2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SCGB2A2-854H
• Product Overview: SCGB2A2 MS Standard C13 and N15-labeled recombinant protein (NP_002402) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: SCGB2A2 (Secretoglobin Family 2A Member 2) is a Protein Coding gene. Diseases associated with SCGB2A2 include Breast Cancer and Lung Cancer Susceptibility 3. An important paralog of this gene is SCGB2A1.
• Molecular Mass: 10.5 kDa
• AA Sequence: MKLLMVLMLAALSQHCYAGSGCPLLENVISKTINPQVSKTEYKELLQEFIDDNATTNAIDELKECFLNQTDETLSNVEVFMQLIYDSSLCDLFTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SCGB2A2 secretoglobin family 2A member 2 [ Homo sapiens (human) ]
• Official Symbol: SCGB2A2
• Synonyms: SCGB2A2; secretoglobin, family 2A, member 2; mammaglobin 1, MGB1; mammaglobin-A; mammaglobin A; MGC71974; UGB2; mammaglobin 1; mammaglobin-1; MGB1
• Gene ID: 4250
• mRNA Refseq: NM_002411
• Protein Refseq: NP_002402
• MIM: 605562
• UniProt ID: Q13296