Recombinant Human SCGB2A2, His-tagged

• Cat.No.: SCGB2A2-29237TH
• Product Overview: Recombinant Full length Human Mammaglobin A with an N terminal His tag; 87 amino acids, MWt 9.88kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 75 amino acids
• Description: The mammaglobin gene was first identified using a differential screening approach directed at the isolation of novel, human breast cancer-associated genes.
• Conjugation: HIS
• Molecular Weight: 9.880kDa inclusive of tags
• Tissue specificity: Mammary gland specific. Over-expressed in breast cancer.
• Form: Lyophilised:Add deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80°C for long term sto
• Storage buffer: pH: 7.20Constituents:0.29% Sodium chloride, 0.69% Phosphate Buffer
• Storage: Store at -80°C
• Sequences of amino acids: MRGSHHHHHHGSGSGCPLLENVISKTINPQVSKTEYKELLQEFIDDNATTNAIDELKECFLNQTDETLSNVEVFMQLIYDSSLCDLF
• Sequence Similarities: Belongs to the secretoglobin family. Lipophilin subfamily.

Gene Information

• Gene Name: SCGB2A2 secretoglobin, family 2A, member 2 [ Homo sapiens ]
• Official Symbol: SCGB2A2
• Synonyms: SCGB2A2; secretoglobin, family 2A, member 2; mammaglobin 1 , MGB1; mammaglobin-A; mammaglobin A; MGC71974; UGB2
• Gene ID: 4250
• mRNA Refseq: NM_002411
• Protein Refseq: NP_002402
• MIM: 605562
• Uniprot ID: Q13296
• Chromosome Location: 11q13
• Function: binding; molecular_function; steroid binding