Recombinant Human SCG2 protein, His-GST-tagged

• Cat.No.: SCG2-4548H
• Product Overview: Recombinant Human SCG2 protein(P13521)(418-617aa), fused to N-terminal His tag and GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST&His
• Protein Length: 418-617aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 54.3 kDa
• AA Sequence: TPGRAGTEALPDGLSVEDILNLLGMESAANQKTSYFPNPYNQEKVLPRLPYGAGRSRSNQLPKAAWIPHVENRQMAYENLNDKDQELGEYLARMLVKYPEIINSNQVKRVPGQGSSEDDLQEEEQIEQAIKEHLNQGSSQETDKLAPVSKRFPVGPPKNDDTPNRQYWDEDLLMKVLEYLNQEKAEKGREHIAKRAMENM
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: SCG2 secretogranin II [ Homo sapiens ]
• Official Symbol: SCG2
• Synonyms: SCG2; secretogranin II; secretogranin-2; CHGC; chromogranin C; secretoneurin; SgII; SN; chromogranin-C; EM66
• Gene ID: 7857
• mRNA Refseq: NM_003469
• Protein Refseq: NP_003460
• MIM: 118930
• UniProt ID: P13521