Recombinant Human SCG2 protein(261-380 aa), C-His-tagged

• Cat.No.: SCG2-2648H
• Product Overview: Recombinant Human SCG2 protein(P13521)(261-380 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 261-380 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: TQEEVRDSKENIEKNEQINDEMKRSGQLGIQEEDLRKESKDQLSDDVSKVIAYLKRLVNAAGSGRLQNGQNGERATRLFEKPLDSQSIYQLIEISRNLQIPPEDLIEMLKTGEKPNGSVE

Gene Information

• Gene Name: SCG2 secretogranin II [ Homo sapiens ]
• Official Symbol: SCG2
• Synonyms: SCG2; secretogranin II; secretogranin-2; CHGC; chromogranin C; secretoneurin; SgII; SN; chromogranin-C; EM66
• Gene ID: 7857
• mRNA Refseq: NM_003469
• Protein Refseq: NP_003460
• MIM: 118930
• UniProt ID: P13521