Recombinant Human SCARB2 protein(71-180 aa), C-His-tagged
Cat.No. : | SCARB2-2867H |
Product Overview : | Recombinant Human SCARB2 protein(Q14108)(71-180 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 71-180 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | NPEEILRGETPRVEEVGPYTYRELRNKANIQFGDNGTTISAVSNKAYVFERDQSVGDPKIDLIRTLNIPVLTVIEWSQVHFLREIIEAMLKAYQQKLFVTHTVDELLWGY |
Gene Name | SCARB2 scavenger receptor class B, member 2 [ Homo sapiens ] |
Official Symbol | SCARB2 |
Synonyms | SCARB2; scavenger receptor class B, member 2; CD36 antigen (collagen type I receptor, thrombospondin receptor) like 2 (lysosomal integral membrane protein II) , CD36L2; lysosome membrane protein 2; HLGP85; LIMP 2; LIMPII; SR BII; LIMP II; CD36 antigen-like 2; lysosome membrane protein II; 85 kDa lysosomal membrane sialoglycoprotein; 85 kDa lysosomal sialoglycoprotein scavenger receptor class B, member 2; CD36 antigen (collagen type I receptor, thrombospondin receptor)-like 2 (lysosomal integral membrane protein II); AMRF; EPM4; LGP85; CD36L2; LIMP-2; SR-BII; |
Gene ID | 950 |
mRNA Refseq | NM_001204255 |
Protein Refseq | NP_001191184 |
MIM | 602257 |
UniProt ID | Q14108 |
◆ Recombinant Proteins | ||
SCARB2-2188H | Active Recombinant Human SCARB2 protein, His&hFc-tagged | +Inquiry |
SCARB2-2663H | Recombinant Human SCARB2 protein, His-tagged | +Inquiry |
SCARB2-470H | Recombinant Human SCARB2 Protein, MYC/DDK-tagged | +Inquiry |
SCARB2-1755H | Recombinant Human SCARB2 protein, GST-tagged | +Inquiry |
SCARB2-5244R | Recombinant Rat SCARB2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SCARB2-2413MCL | Recombinant Mouse SCARB2 cell lysate | +Inquiry |
SCARB2-2752HCL | Recombinant Human SCARB2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SCARB2 Products
Required fields are marked with *
My Review for All SCARB2 Products
Required fields are marked with *
0
Inquiry Basket