Recombinant Human SBK1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SBK1-5285H
Product Overview : SBK1 MS Standard C13 and N15-labeled recombinant protein (NP_001019572) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : SBK1 (SH3 Domain Binding Kinase 1) is a Protein Coding gene. Diseases associated with SBK1 include Punctate Epithelial Keratoconjunctivitis and Corneal Ectasia. Gene Ontology (GO) annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is SBK3.
Molecular Mass : 46.1 kDa
AA Sequence : MSVGCPEPEPPRSLTCCGPGTAPGPGAGVPLLTEDMQALTLRTLAASDVTKHYELVRELGKGTYGKVDLVVYKGTGTKMALKFVNKSKTKLKNFLREVSITNSLSSSPFIIKVFDVVFETEDCYVFAQEYAPAGDLFDIIPPQVGLPEDTVKRCVQQLGLALDFMHGRQLVHRDIKPENVLLFDRECRRVKLADFGMTRRVGCRVKRVSGTIPYTAPEVCQAGRADGLAVDTGVDVWAFGVLIFCVLTGNFPWEAASGADAFFEEFVRWQRGRLPGLPSQWRRFTEPALRMFQRLLALEPERRGPAKEVFRFLKHELTSELRRRPSHRARKPPGDRPPAAGPLRLEAPGPLKRTVLTESGSGSRPAPPAVGSVPLPVPVPVPVPVPVPVPEPGLAPQGPPGRTDGRADKSKGQVVLATAIEICVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SBK1 SH3-binding domain kinase 1 [ Homo sapiens (human) ]
Official Symbol SBK1
Synonyms SBK1; SH3-binding domain kinase 1; serine/threonine-protein kinase SBK1; Sbk; SH3-binding kinase 1;
Gene ID 388228
mRNA Refseq NM_001024401
Protein Refseq NP_001019572
UniProt ID Q52WX2

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SBK1 Products

Required fields are marked with *

My Review for All SBK1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon