Recombinant Human SAYSD1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SAYSD1-5094H
Product Overview : C6orf64 MS Standard C13 and N15-labeled recombinant protein (NP_060792) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : SAYSD1 (SAYSVFN Motif Domain Containing 1) is a Protein Coding gene.
Source : HEK293
Species : Human
Tag : Myc&DDK
Molecular Mass : 20.2 kDa
AA Sequence : MEQRLAEFRAARKRAGLAAQPPAASQGAQTPGEKAEAAATLKAAPGWLKRFLVWKPRPASARAQPGLVQEAAQPQGSTSETPWNTAIPLPSCWDQSFLTNITFLKVLLWLVLLGLFVELEFGLAYFVLSLFYWMYVGTRGPEEKKEGEKSAYSVFNPGCEAIQGTLTAEQLERELQLRPLAGRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SAYSD1 SAYSVFN motif domain containing 1 [ Homo sapiens (human) ]
Official Symbol SAYSD1
Synonyms SAYSD1; SAYSVFN motif domain containing 1; C6orf64; SAYSvFN domain-containing protein 1
Gene ID 55776
mRNA Refseq NM_018322
Protein Refseq NP_060792
UniProt ID Q9NPB0

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SAYSD1 Products

Required fields are marked with *

My Review for All SAYSD1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon