Recombinant Human SAT2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SAT2-4971H
• Product Overview: SAT2 MS Standard C13 and N15-labeled recombinant protein (NP_597998) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: Enzyme which catalyzes the acetylation of polyamines. Substrate specificity: norspermidine > spermidine = spermine >> N(1)acetylspermine = putrescine.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 19.2 kDa
• AA Sequence: MASVRIREAKEGDCGDILRLIRELAEFEKLSDQVKISEEALRADGFGDNPFYHCLVAEILPAPGKLLGPCVVGYGIYYFIYSTWKGRTIYLEDIYVMPEYRGQGIGSKIIKKVAEVALDKGCSQFRLAVLDWNQRAMDLYKALGAQDLTEAEGWHFFCFQGEATRKLAGKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SAT2 spermidine/spermine N1-acetyltransferase family member 2 [ Homo sapiens (human) ]
• Official Symbol: SAT2
• Synonyms: SAT2; spermidine/spermine N1-acetyltransferase family member 2; spermidine/spermine N1 acetyltransferase 2; diamine acetyltransferase 2; diamine N acetyltransferase 2; SSAT2; diamine N-acetyltransferase 2; polyamine N-acetyltransferase 2; thialysine N-epsilon-acetyltransferase; spermidine/spermine N1-acetyltransferase 2; spermidine/spermine N(1)-acetyltransferase 2
• Gene ID: 112483
• mRNA Refseq: NM_133491
• Protein Refseq: NP_597998
• MIM: 611463
• UniProt ID: Q96F10