Recombinant Human SARNP, His-tagged

Cat.No. : SARNP-27193TH
Product Overview : Recombinant full length protein, corresponding to amino acids 1-210 of Human CIP29 with N terminal His tag, Predicted MWt 25 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-210 a.a.
Description : This gene encodes a protein that is upregulated in response to various cytokines. The encoded protein may play a role in cell cycle progression. A translocation between this gene and the myeloid/lymphoid leukemia gene, resulting in expression of a chimeric protein, has been associated with acute myelomonocytic leukemia. Pseudogenes exist on chromosomes 7 and 8. Alternatively spliced transcript variants have been described.
Conjugation : HIS
Form : Lyophilised:Reconstitute with 112 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MATETVELHKLKLAELKQECLARGLETKGIKQDLIHRLQA YLEEHAEEEANEEDVLGDETEEEETKPIELPVKEEEPP EKTVDVAAEKKVVKITSEIPQTERMQKRAERFNVPVSL ESKKAARAARFGISSVPTKGLSSDNKPMVNLDKLKERA QRFGLNVSSISRKSEDDEKLKKRKERFGIVTSSAGTGTTE DTEAKKRKRAERFGIA
Full Length : Full L.
Gene Name SARNP SAP domain containing ribonucleoprotein [ Homo sapiens ]
Official Symbol SARNP
Synonyms SARNP; SAP domain containing ribonucleoprotein; SAP domain-containing ribonucleoprotein; CIP29; cytokine induced protein 29 kDa; Hcc 1; hepatocellular carcinoma 1; THO1;
Gene ID 84324
mRNA Refseq NM_033082
Protein Refseq NP_149073
MIM 610049
Uniprot ID P82979
Chromosome Location 12q13.2
Function DNA binding; RNA binding; RS domain binding; nucleic acid binding; protein C-terminus binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SARNP Products

Required fields are marked with *

My Review for All SARNP Products

Required fields are marked with *

0

Inquiry Basket

cartIcon