Recombinant Human SARAF Protein (195-339 aa), His-tagged

• Cat.No.: SARAF-1752H
• Product Overview: Recombinant Human SARAF Protein (195-339 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Biochemicals. Protein Description: Partial.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• ProteinLength: 195-339 aa
• Description: Negative regulator of store-operated Ca2+ entry (SOCE) involved in protecting cells from Ca2+ overfilling. In response to cytosolic Ca2+ elevation after endoplasmic reticulum Ca2+ refilling, promotes a slow inactivation of STIM (STIM1 or STIM2)-dependent SOCE activity: possibly act by facilitating the deoligomerization of STIM to efficiently turn off ORAI when the endoplasmic reticulum lumen is filled with the appropriate Ca2+ levels, and thus preventing the overload of the cell with excessive Ca2+ ions.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 17.5 kDa
• AA Sequence: SDGQYSPPPYSEYPPFSHRYQRFTNSAGPPPPGFKSEFTGPQNTGHGATSGFGSAFTGQQGYENSGPGFWTGLGTGGILGYLFGSNRAATPFSDSWYYPSYPPSYPGTWNRAYSPLHGGSGSYSVCSNSDTKTRTASGYGGTRRR
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: SARAF store-operated calcium entry associated regulatory factor [ Homo sapiens (human) ]
• Official Symbol: SARAF
• Synonyms: XTP3; FOAP-7; TMEM66; HSPC035
• Gene ID: 51669
• mRNA Refseq: NM_001284239
• Protein Refseq: NP_001271168
• UniProt ID: Q96BY9