Recombinant Human SAP18 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SAP18-4660H
• Product Overview: SAP18 MS Standard C13 and N15-labeled recombinant protein (NP_005861) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: Histone acetylation plays a key role in the regulation of eukaryotic gene expression. Histone acetylation and deacetylation are catalyzed by multisubunit complexes. The protein encoded by this gene is a component of the histone deacetylase complex, which includes SIN3, SAP30, HDAC1, HDAC2, RbAp46, RbAp48, and other polypeptides. This protein directly interacts with SIN3 and enhances SIN3-mediated transcriptional repression when tethered to the promoter. A pseudogene has been identified on chromosome 2.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 17.6 kDa
• AA Sequence: MAVESRVTQEEIKKEPEKPIDREKTCPLLLRVFTTNNGRHHRMDEFSRGNVPSSELQIYTWMDATLKELTSLVKEVYPEARKKGTHFNFAIVFTDVKRPGYRVKEIGSTMSGRKGTDDSMTLQSQKFQIGDYLDIAITPPNRAPPTSGRMRPYTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SAP18 Sin3A associated protein 18 [ Homo sapiens (human) ]
• Official Symbol: SAP18
• Synonyms: SAP18; Sin3A-associated protein, 18kDa; sin3A associated protein, 18kDa; histone deacetylase complex subunit SAP18; 2HOR0202; MGC27131; SAP18p; sin3-associated polypeptide p18; sin3-associated polypeptide, p18; cell growth inhibiting protein 38; cell growth-inhibiting protein 38; 18 kDa Sin3-associated polypeptide; sin3-associated polypeptide, 18 kDa; cell growth-inhibiting gene 38 protein; histone deacetlyase complex subunit SAP18; SAP18P
• Gene ID: 10284
• mRNA Refseq: NM_005870
• Protein Refseq: NP_005861
• MIM: 602949
• UniProt ID: O00422