Recombinant Human SAMD8 protein, GST-tagged

• Cat.No.: SAMD8-301227H
• Product Overview: Recombinant Human SAMD8 (1-152 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Protein length: Met1-Thr152
• AA Sequence: MAGPNQLCIRRWTTKHVAVWLKDEGFFEYVDILCNKHRLDGITLLTLTEYDLRSPPLEIKVLGDIKRLMLSVRKLQKIHIDVLEEMGYNSDSPMGSMTPFISALQSTDWLCNGELSHDCDGPITDLNSDQYQYMNGKNKHSVRRLDPEYWKT
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.

Gene Information

• Gene Name: SAMD8 sterile alpha motif domain containing 8 [ Homo sapiens ]
• Official Symbol: SAMD8
• Synonyms: SAMD8; sterile alpha motif domain containing 8; sphingomyelin synthase-related protein 1; FLJ25082; sphingomyelin synthase related; SAM domain-containing protein 8; sterile alpha motif domain-containing protein 8; SMSr
• Gene ID: 142891
• mRNA Refseq: NM_001174156
• Protein Refseq: NP_001167627
• MIM: 611575
• UniProt ID: Q96LT4