Recombinant Human SAA protein

• Cat.No.: SAA-61H
• Product Overview: Recombinant Human SAA protein was expressed in Escherichia coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Protein Length: 104
• Description: Serum amyloid A protein which belongs to the SAA family is encoded by the SAA gene in humans. It is expressed by the liver and secreted in plasma. Serum amyloid A is the major acute phase reactant and apolipoprotein of the HDL complex. Elevated serum SAA protein levels may be associated with lung cancer. The level of Apo-SAA, normally 1-5 μg/ml in plasma, increases 500-1000 fold within 24 hours of an inflammatory stimulus and, under these conditions, is the most abundant HDL Apo-lipoprotein. Recombinant human Apo-SAA1 is an 11.7 kDa protein containing 104 amino acid residues.
• Form: Lyophilized from a 0.2μm filtered concentrated solution in 20 mM Tris-HCl, pH 9.0, 150 mM NaCl.
• Bio-activity: Fully biologically active when compared to standard. The biological activity determined by its ability to down-regulate lipid biosynthesis in aortic smooth muscle cells. The effective concentration was found to be 4 μM.
• Molecular Mass: Approximately 11.7 kDa, a single non-glycosylated polypeptide chain containing 104 amino acids.
• AA Sequence: RSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISNARENIQRFFGRGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY
• Purity: >98% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: SAA
• Official Symbol: SAA
• Gene ID: 6288
• mRNA Refseq: NM_000331
• Protein Refseq: NP_000322
• MIM: 104750
• UniProt ID: P0DJI8