Recombinant Human S1PR1 Protein, GST-tagged

Description :	The protein encoded by this gene is structurally similar to G protein-coupled receptors and is highly expressed in endothelial cells. It binds the ligand sphingosine-1-phosphate with high affinity and high specificity, and suggested to be involved in the processes that regulate the differentiation of endothelial cells. Activation of this receptor induces cell-cell adhesion. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2016]
Source :	Wheat Germ
Species :	Human
Tag :	GST
Molecular Mass :	69.2 kDa
AA Sequence :	MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFIILENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLREGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNNFRLFLLISACWVISLILGGLPIMGWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKNISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLAVLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSHPQKDEGDNPETIMSSGNVNSSS
Applications :	Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array
Notes :	Best use within three months from the date of receipt of this protein.
Storage :	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Name	S1PR1 sphingosine-1-phosphate receptor 1 [ Homo sapiens ]
Official Symbol	S1PR1
Synonyms	S1PR1; sphingosine-1-phosphate receptor 1; EDG1, endothelial differentiation, sphingolipid G protein coupled receptor, 1; sphingosine 1-phosphate receptor 1; CD363; D1S3362; edg 1; S1P receptor 1; S1P receptor Edg-1; sphingosine 1-phosphate receptor EDG1; sphingosine 1-phosphate receptor Edg-1; endothelial differentiation G-protein coupled receptor 1; endothelial differentiation, sphingolipid G-protein-coupled receptor, 1; EDG1; S1P1; ECGF1; EDG-1; CHEDG1; FLJ58121;
Gene ID	1901
mRNA Refseq	NM_001400
Protein Refseq	NP_001391
MIM	601974
UniProt ID	P21453