Recombinant Human S1PR1 protein

• Cat.No.: S1PR1-28462TH
• Product Overview: Recombinant Human S1PR1(1 a.a. - 288 a.a.) was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 1-288 a.a.
• Description: The protein encoded by this gene is structurally similar to G protein-coupled receptors and is highly expressed in endothelial cells. It binds the ligand sphingosine-1-phosphate with high affinity and high specificity, and suggested to be involved in the processes that regulate the differentiation of endothelial cells. Activation of this receptor induces cell-cell adhesion.
• Form: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
• Molecular Mass: 42.8 kDa
• AA Sequence: MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFIILENIFVLLTIWKTKK FHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLREGSMFVALSASVFSLLAIAIERYITMLKMK LHNGSNNFRLFLLISACWVISLILGGLPIMGWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIY SLVRTRSRRLTFRKNISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLA VLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSHPQKDEGDNPETIMSS GNVNSSS
• Applications: Antibody Production; Functional Study; Compound Screening
• Notes: Best use within three months from the date of receipt of this protein. Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: S1PR1 sphingosine-1-phosphate receptor 1 [ Homo sapiens ]
• Official Symbol: S1PR1
• Synonyms: S1PR1; sphingosine-1-phosphate receptor 1; EDG1, endothelial differentiation, sphingolipid G protein coupled receptor, 1; sphingosine 1-phosphate receptor 1; CD363; D1S3362; edg 1; S1P receptor 1; S1P receptor Edg-1; sphingosine 1-phosphate receptor EDG1; sphingosine 1-phosphate receptor Edg-1; endothelial differentiation G-protein coupled receptor 1; endothelial differentiation, sphingolipid G-protein-coupled receptor, 1; EDG1; S1P1; ECGF1; EDG-1; CHEDG1; FLJ58121
• Gene ID: 1901
• mRNA Refseq: NM_001400
• Protein Refseq: NP_001391
• MIM: 601974
• UniProt ID: P21453
• Chromosome Location: 1p21
• Pathway: Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Fc-epsilon receptor I signaling in mast cells, organism-specific biosystem; G alpha (i) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; GPCRs, Other, organism-specific biosystem; Lysosphingolipid and LPA receptors, organism-specific biosystem
• Function: G-protein coupled receptor activity; receptor activity; signal transducer activity; sphingolipid binding; sphingosine-1-phosphate receptor activity