Recombinant Human S100Z Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: S100Z-4683H
• Product Overview: S100Z MS Standard C13 and N15-labeled recombinant protein (NP_570128) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Members of the S100 protein family contain 2 calcium-binding EF-hands and exhibit cell-type specific expression patterns. For additional background information on S100 proteins.
• Molecular Mass: 11.6 kDa
• AA Sequence: MPTQLEMAMDTMIRIFHRYSGKARKRFKLSKGELKLLLQRELTEFLSCQKETQLVDKIVQDLDANKDNEVDFNEFVVMVAALTVACNDYFVEQLKKKGKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: S100Z S100 calcium binding protein Z [ Homo sapiens (human) ]
• Official Symbol: S100Z
• Synonyms: S100Z; S100 calcium binding protein Z; S100 calcium binding protein, zeta; protein S100-Z; Gm625; S100 zeta; S100 calcium-binding protein Z; S100-zeta
• Gene ID: 170591
• mRNA Refseq: NM_130772
• Protein Refseq: NP_570128
• MIM: 610103
• UniProt ID: Q8WXG8