Recombinant Human S100P Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: S100P-3900H
• Product Overview: S100P MS Standard C13 and N15-labeled recombinant protein (NP_005971) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21; however, this gene is located at 4p16. This protein, in addition to binding Ca2+, also binds Zn2+ and Mg2+. This protein may play a role in the etiology of prostate cancer.
• Molecular Mass: 10.4 kDa
• AA Sequence: MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEFIVFVAAITSACHKYFEKAGLKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: S100P S100 calcium binding protein P [ Homo sapiens (human) ]
• Official Symbol: S100P
• Synonyms: S100P; S100 calcium binding protein P; protein S100-P; protein S100-E; migration-inducing gene 9; S100 calcium-binding protein P; MIG9
• Gene ID: 6286
• mRNA Refseq: NM_005980
• Protein Refseq: NP_005971
• MIM: 600614
• UniProt ID: P25815