Recombinant Human S100A9, StrepII-tagged

• Cat.No.: S100A9-295H
• Product Overview: Purified, full-length human recombinant S100A9 protein (amino acids 2-114, 113 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 13.2 kDa. (Accession NP_002956; UniProt P06702)

Specification

• Description: S100A9 is a calcium- and zinc-binding protein which plays a prominent role in the regulation of inflammatory processes and immune response. This protein, which may function in the inhibition of casein kinase and as a cytokine, can induce neutrophil chemotaxis and adhesion. It is a member of S-100 family and contains 2 EF-hand calcium binding domains. Although it can exist as a homodimer, it preferentially exists as a heterodimer or heterotetramer with S100A8 [Cat. No. 90122] known as calprotectin (S100A8/A9).
• Source: Human Cells
• Species: Human
• Tag: StrepII
• Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free)
• Protein length: 2-114, 113 a.a.
• AA Sequence: TCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSF EEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP
• Endotoxin: <0.1 eu per μg protein by lal
• Purity: >95% by SDS-PAGE
• Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
• Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml. This solution can then be diluted into other aqueous buffers and stored at 4°C for up to 1 month.

Gene Information

• Gene Name: S100A9 S100 calcium binding protein A9 [ Homo sapiens ]
• Official Symbol: S100A9
• Synonyms: S100A9; S100 calcium binding protein A9; CAGB, CFAG, S100 calcium binding protein A9 (calgranulin B) , S100 calcium binding protein A9 (calgranulin B); protein S100-A9; 60B8AG; CGLB; LIAG; MAC387; MIF; MRP14; NIF; P14; MRP-14; calgranulin B; calgranulin-B; calprotectin L1H subunit; leukocyte L1 complex heavy chain; migration inhibitory factor-related protein 14; S100 calcium-binding protein A9 (calgranulin B); CAGB; CFAG; L1AG
• Gene ID: 6280
• mRNA Refseq: NM_002965
• Protein Refseq: NP_002956
• MIM: 123886
• UniProt ID: P06702
• Chromosome Location: 1q21
• Function: calcium ion binding; protein binding; signal transducer activity