Recombinant Human S100A9, StrepII-tagged
Cat.No. : | S100A9-295H |
Product Overview : | Purified, full-length human recombinant S100A9 protein (amino acids 2-114, 113 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 13.2 kDa. (Accession NP_002956; UniProt P06702) |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Strep II |
Protein Length : | 2-114, 113 a.a. |
Description : | S100A9 is a calcium- and zinc-binding protein which plays a prominent role in the regulation of inflammatory processes and immune response. This protein, which may function in the inhibition of casein kinase and as a cytokine, can induce neutrophil chemotaxis and adhesion. It is a member of S-100 family and contains 2 EF-hand calcium binding domains. Although it can exist as a homodimer, it preferentially exists as a heterodimer or heterotetramer with S100A8 [Cat. No. 90122] known as calprotectin (S100A8/A9). |
Form : | Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free) |
AA Sequence : | TCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSF EEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP |
Endotoxin : | <0.1 eu per μg protein by lal |
Purity : | >95% by SDS-PAGE |
Storage : | 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles. |
Reconstitution : | Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml. This solution can then be diluted into other aqueous buffers and stored at 4°C for up to 1 month. |
Gene Name | S100A9 S100 calcium binding protein A9 [ Homo sapiens ] |
Official Symbol | S100A9 |
Synonyms | S100A9; S100 calcium binding protein A9; CAGB, CFAG, S100 calcium binding protein A9 (calgranulin B) , S100 calcium binding protein A9 (calgranulin B); protein S100-A9; 60B8AG; CGLB; LIAG; MAC387; MIF; MRP14; NIF; P14; MRP-14; calgranulin B; calgranulin-B; calprotectin L1H subunit; leukocyte L1 complex heavy chain; migration inhibitory factor-related protein 14; S100 calcium-binding protein A9 (calgranulin B); CAGB; CFAG; L1AG; |
Gene ID | 6280 |
mRNA Refseq | NM_002965 |
Protein Refseq | NP_002956 |
MIM | 123886 |
UniProt ID | P06702 |
Chromosome Location | 1q21 |
Function | calcium ion binding; protein binding; signal transducer activity; |
◆ Recombinant Proteins | ||
S100A9-433H | Recombinant Human S100 Calcium Binding Protein A9, Cys3Ser Mutated | +Inquiry |
S100A9-6221H | Recombinant Human S100A9 Protein (Thr2-Pro114), N-His tagged | +Inquiry |
S100A9-1944H | Recombinant Human S100A9 Protein, His (Fc)-Avi-tagged | +Inquiry |
S100A9-1805C | Recombinant Cattle S100A9 protein, His & T7-tagged | +Inquiry |
S100A9-1019H | Active Recombinant Human Calprotectin S100A9 Protein | +Inquiry |
◆ Native Proteins | ||
S100A9-3179H | Native Human S100A9 protein(Met1-Pro114) | +Inquiry |
◆ Cell & Tissue Lysates | ||
S100A9-684HCL | Recombinant Human S100A9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All S100A9 Products
Required fields are marked with *
My Review for All S100A9 Products
Required fields are marked with *
0
Inquiry Basket