Recombinant Human S100A9, StrepII-tagged

Cat.No. : S100A9-295H
Product Overview : Purified, full-length human recombinant S100A9 protein (amino acids 2-114, 113 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 13.2 kDa. (Accession NP_002956; UniProt P06702)
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Human Cells
Tag : Strep II
Protein Length : 2-114, 113 a.a.
Description : S100A9 is a calcium- and zinc-binding protein which plays a prominent role in the regulation of inflammatory processes and immune response. This protein, which may function in the inhibition of casein kinase and as a cytokine, can induce neutrophil chemotaxis and adhesion. It is a member of S-100 family and contains 2 EF-hand calcium binding domains. Although it can exist as a homodimer, it preferentially exists as a heterodimer or heterotetramer with S100A8 [Cat. No. 90122] known as calprotectin (S100A8/A9).
Form : Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free)
AA Sequence : TCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSF EEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP
Endotoxin : <0.1 eu per μg protein by lal
Purity : >95% by SDS-PAGE
Storage : 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
Reconstitution : Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml. This solution can then be diluted into other aqueous buffers and stored at 4°C for up to 1 month.
Gene Name S100A9 S100 calcium binding protein A9 [ Homo sapiens ]
Official Symbol S100A9
Synonyms S100A9; S100 calcium binding protein A9; CAGB, CFAG, S100 calcium binding protein A9 (calgranulin B) , S100 calcium binding protein A9 (calgranulin B); protein S100-A9; 60B8AG; CGLB; LIAG; MAC387; MIF; MRP14; NIF; P14; MRP-14; calgranulin B; calgranulin-B; calprotectin L1H subunit; leukocyte L1 complex heavy chain; migration inhibitory factor-related protein 14; S100 calcium-binding protein A9 (calgranulin B); CAGB; CFAG; L1AG;
Gene ID 6280
mRNA Refseq NM_002965
Protein Refseq NP_002956
MIM 123886
UniProt ID P06702
Chromosome Location 1q21
Function calcium ion binding; protein binding; signal transducer activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All S100A9 Products

Required fields are marked with *

My Review for All S100A9 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon