Recombinant Human S100A7L2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : S100A7L2-6033H
Product Overview : S100A7L2 MS Standard C13 and N15-labeled recombinant protein (NP_001038944) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This locus is currently categorized as a non-transcribed pseudogene, but the locus type of this gene is unclear since it does contain an intact CDS. This locus lacks evidence indicating that it is transcribed, and very little of the upstream regions found in other family members are present at this locus.
Molecular Mass : 12.3 kDa
AA Sequence : MLPSSGFLKAKMNIPLGEKVMLDIVAMFRQYSGDDGRMDMPGLVNLMKENFPNFLSGCEKSDMDYLSNALEKKDDNKDKKVNYSEFLSLLGDITIDHHKIMHGVAPCSGGSQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name S100A7L2 S100 calcium binding protein A7 like 2 [ Homo sapiens (human) ]
Official Symbol S100A7L2
Synonyms S100A7L2; S100 calcium binding protein A7 like 2; S100a7b; protein S100-A7-like 2
Gene ID 645922
mRNA Refseq NM_001045479
Protein Refseq NP_001038944

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All S100A7L2 Products

Required fields are marked with *

My Review for All S100A7L2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon