Recombinant Human S100A7L2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: S100A7L2-6033H
• Product Overview: S100A7L2 MS Standard C13 and N15-labeled recombinant protein (NP_001038944) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: This locus is currently categorized as a non-transcribed pseudogene, but the locus type of this gene is unclear since it does contain an intact CDS. This locus lacks evidence indicating that it is transcribed, and very little of the upstream regions found in other family members are present at this locus.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 12.3 kDa
• AA Sequence: MLPSSGFLKAKMNIPLGEKVMLDIVAMFRQYSGDDGRMDMPGLVNLMKENFPNFLSGCEKSDMDYLSNALEKKDDNKDKKVNYSEFLSLLGDITIDHHKIMHGVAPCSGGSQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: S100A7L2 S100 calcium binding protein A7 like 2 [ Homo sapiens (human) ]
• Official Symbol: S100A7L2
• Synonyms: S100A7L2; S100 calcium binding protein A7 like 2; S100a7b; protein S100-A7-like 2
• Gene ID: 645922
• mRNA Refseq: NM_001045479
• Protein Refseq: NP_001038944