Recombinant Human S100A7 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | S100A7-4977H |
Product Overview : | S100A7 MS Standard C13 and N15-labeled recombinant protein (NP_002954) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein differs from the other S100 proteins of known structure in its lack of calcium binding ability in one EF-hand at the N-terminus. The protein is overexpressed in hyperproliferative skin diseases, exhibits antimicrobial activities against bacteria and induces immunomodulatory activities. |
Molecular Mass : | 11.5 kDa |
AA Sequence : | MSNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | S100A7 S100 calcium binding protein A7 [ Homo sapiens (human) ] |
Official Symbol | S100A7 |
Synonyms | S100A7; S100 calcium binding protein A7; PSOR1, S100 calcium binding protein A7 (psoriasin 1), S100 calcium binding protein A7 (psoriasin 1); protein S100-A7; S100A7c; psoriasin 1; S100 calcium-binding protein A7 (psoriasin 1); PSOR1; |
Gene ID | 6278 |
mRNA Refseq | NM_002963 |
Protein Refseq | NP_002954 |
MIM | 600353 |
UniProt ID | P31151 |
◆ Recombinant Proteins | ||
S100A7-1213C | Recombinant Cattle S100A7 Protein, His-tagged | +Inquiry |
S100A7-4977H | Recombinant Human S100A7 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
S100A7-6218H | Recombinant Human S100A7 Protein (Met1-Gln101), N-His tagged | +Inquiry |
S100A7-2491H | Recombinant Human S100A7, GST-tagged | +Inquiry |
S100A7-633HF | Recombinant Full Length Human S100A7 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
S100A7-3195H | Native Human S100A7 protein(Met1-Gln101) | +Inquiry |
◆ Cell & Tissue Lysates | ||
S100A7-2088HCL | Recombinant Human S100A7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All S100A7 Products
Required fields are marked with *
My Review for All S100A7 Products
Required fields are marked with *
0
Inquiry Basket