Recombinant Human S100A7 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: S100A7-4977H
• Product Overview: S100A7 MS Standard C13 and N15-labeled recombinant protein (NP_002954) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein differs from the other S100 proteins of known structure in its lack of calcium binding ability in one EF-hand at the N-terminus. The protein is overexpressed in hyperproliferative skin diseases, exhibits antimicrobial activities against bacteria and induces immunomodulatory activities.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 11.5 kDa
• AA Sequence: MSNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: S100A7 S100 calcium binding protein A7 [ Homo sapiens (human) ]
• Official Symbol: S100A7
• Synonyms: S100A7; S100 calcium binding protein A7; PSOR1, S100 calcium binding protein A7 (psoriasin 1), S100 calcium binding protein A7 (psoriasin 1); protein S100-A7; S100A7c; psoriasin 1; S100 calcium-binding protein A7 (psoriasin 1); PSOR1
• Gene ID: 6278
• mRNA Refseq: NM_002963
• Protein Refseq: NP_002954
• MIM: 600353
• UniProt ID: P31151