Recombinant Human S100A7 protein, GST-tagged

• Cat.No.: S100A7-185H
• Product Overview: Recombinant Human S100A7(1 a.a. - 101 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Description: The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein differs from the other S100 proteins of known structure in its lack of calcium binding ability in one EF-hand at the N-terminus. The protein is overexpressed in hyperproliferative skin diseases, exhibits antimicrobial activities against bacteria and induces immunomodulatory activities.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 36.85 Kd
• AA Sequence: MSNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEF LSLLGDIATDYHKQSHGAAPCSGGSQ
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Protein length: 1-101 a.a.

Gene Information

• Gene Name: S100A7 S100 calcium binding protein A7 [ Homo sapiens ]
• Official Symbol: S100A7
• Synonyms: S100A7; S100 calcium binding protein A7; PSOR1, S100 calcium binding protein A7 (psoriasin 1) , S100 calcium binding protein A7 (psoriasin 1); protein S100-A7; S100A7c; psoriasin 1; S100 calcium-binding protein A7 (psoriasin 1); PSOR1
• Gene ID: 6278
• mRNA Refseq: NM_002963
• Protein Refseq: NP_002954
• MIM: 600353
• UniProt ID: P31151
• Chromosome Location: 1q21
• Pathway: Validated targets of C-MYC transcriptional repression, organism-specific biosystem
• Function: RAGE receptor binding; calcium ion binding; protein binding; zinc ion binding; zinc ion binding