Recombinant Human S100A7 protein, GST-tagged
Cat.No. : | S100A7-185H |
Product Overview : | Recombinant Human S100A7(1 a.a. - 101 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Description : | The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein differs from the other S100 proteins of known structure in its lack of calcium binding ability in one EF-hand at the N-terminus. The protein is overexpressed in hyperproliferative skin diseases, exhibits antimicrobial activities against bacteria and induces immunomodulatory activities. |
Source : | Wheat Germ |
Species : | Human |
Tag : | GST |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.85 Kd |
AA Sequence : | MSNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEF LSLLGDIATDYHKQSHGAAPCSGGSQ |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Protein length : | 1-101 a.a. |
Gene Name | S100A7 S100 calcium binding protein A7 [ Homo sapiens ] |
Official Symbol | S100A7 |
Synonyms | S100A7; S100 calcium binding protein A7; PSOR1, S100 calcium binding protein A7 (psoriasin 1) , S100 calcium binding protein A7 (psoriasin 1); protein S100-A7; S100A7c; psoriasin 1; S100 calcium-binding protein A7 (psoriasin 1); PSOR1; |
Gene ID | 6278 |
mRNA Refseq | NM_002963 |
Protein Refseq | NP_002954 |
MIM | 600353 |
UniProt ID | P31151 |
Chromosome Location | 1q21 |
Pathway | Validated targets of C-MYC transcriptional repression, organism-specific biosystem; |
Function | RAGE receptor binding; calcium ion binding; protein binding; zinc ion binding; zinc ion binding; |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All S100A7 Products
Required fields are marked with *
My Review for All S100A7 Products
Required fields are marked with *
0
Inquiry Basket