Recombinant Human S100A6 protein, His-SUMO-tagged

• Cat.No.: S100A6-3462H
• Product Overview: Recombinant Human S100A6 protein(P06703)(1-90aa), fused to N-terminal His-SUMO tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His&SUMO
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 26.2 kDa
• Protein length: 1-90aa
• AA Sequence: MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: S100A6 S100 calcium binding protein A6 [ Homo sapiens ]
• Official Symbol: S100A6
• Synonyms: S100A6; S100 calcium binding protein A6; CACY, S100 calcium binding protein A6 (calcyclin) , S100 calcium binding protein A6 (calcyclin); protein S100-A6; 2A9; CABP; PRA; MLN 4; calcyclin; growth factor-inducible protein 2A9; prolactin receptor-associated protein; S100 calcium-binding protein A6 (calcyclin); 5B10; CACY
• Gene ID: 6277
• mRNA Refseq: NM_014624
• Protein Refseq: NP_055439
• MIM: 114110
• UniProt ID: P06703