Recombinant Human S100A2, His-tagged

Cat.No. : S100A2-31341TH
Product Overview : Recombinant full length Human S100 alpha 2 with an N terminal His tag; 117 amino acids with tag, MWt 13.1 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 97 amino acids
Description : The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may have a tumor suppressor function. Chromosomal rearrangements and altered expression of this gene have been implicated in breast cancer.
Conjugation : HIS
Molecular Weight : 13.100kDa inclusive of tags
Tissue specificity : A subset of epithelial cells including normal human mammary epithelial cells and keratinocytes.
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 30% Glycerol, 0.2M Sodium chloride, 5mM DTT, 20mM Tris HCl, pH 8.0
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMCSSLEQALAVLVTTFHKYSCQEGDKFKLSKGEMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDRP
Sequence Similarities : Belongs to the S-100 family.Contains 2 EF-hand domains.
Gene Name S100A2 S100 calcium binding protein A2 [ Homo sapiens ]
Official Symbol S100A2
Synonyms S100A2; S100 calcium binding protein A2; S100 calcium binding protein A2 , S100L; protein S100-A2; CAN19;
Gene ID 6273
mRNA Refseq NM_005978
Protein Refseq NP_005969
MIM 176993
Uniprot ID P29034
Chromosome Location 1q21
Pathway Direct p53 effectors, organism-specific biosystem;
Function calcium ion binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All S100A2 Products

Required fields are marked with *

My Review for All S100A2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon