Recombinant Human S100A2, His-tagged

• Cat.No.: S100A2-31341TH
• Product Overview: Recombinant full length Human S100 alpha 2 with an N terminal His tag; 117 amino acids with tag, MWt 13.1 kDa.

Specification

• Description: The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may have a tumor suppressor function. Chromosomal rearrangements and altered expression of this gene have been implicated in breast cancer.
• Protein length: 97 amino acids
• Conjugation: HIS
• Molecular Weight: 13.100kDa inclusive of tags
• Source: E. coli
• Tissue specificity: A subset of epithelial cells including normal human mammary epithelial cells and keratinocytes.
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 30% Glycerol, 0.2M Sodium chloride, 5mM DTT, 20mM Tris HCl, pH 8.0
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMCSSLEQALAVLVTTFHKYSCQEGDKFKLSKGEMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDRP
• Sequence Similarities: Belongs to the S-100 family.Contains 2 EF-hand domains.

Gene Information

• Gene Name: S100A2 S100 calcium binding protein A2 [ Homo sapiens ]
• Official Symbol: S100A2
• Synonyms: S100A2; S100 calcium binding protein A2; S100 calcium binding protein A2 , S100L; protein S100-A2; CAN19
• Gene ID: 6273
• mRNA Refseq: NM_005978
• Protein Refseq: NP_005969
• MIM: 176993
• Uniprot ID: P29034
• Chromosome Location: 1q21
• Pathway: Direct p53 effectors, organism-specific biosystem
• Function: calcium ion binding