Recombinant Human S100A16 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: S100A16-1977H
• Product Overview: S100A16 MS Standard C13 and N15-labeled recombinant protein (NP_525127) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Calcium-binding protein. Binds one calcium ion per monomer. Can promote differentiation of adipocytes. Overexpression in preadipocytes increases their proliferation, enhances adipogenesis and reduces insulin-stimulated glucose uptake.
• Molecular Mass: 11.6 kDa
• AA Sequence: MSDCYTELEKAVIVLVENFYKYVSKYSLVKNKISKSSFREMLQKELNHMLSDTGNRKAADKLIQNLDANHDGRISFDEYWTLIGGITGPIAKLIHEQEQQSSSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: S100A16 S100 calcium binding protein A16 [ Homo sapiens (human) ]
• Official Symbol: S100A16
• Synonyms: S100A16; S100 calcium binding protein A16; protein S100-A16; DT1P1A7; MGC17528; S100F; protein S100-F; aging-associated protein 13; S100 calcium-binding protein A16; aging-associated gene 13 protein; AAG13
• Gene ID: 140576
• mRNA Refseq: NM_080388
• Protein Refseq: NP_525127
• MIM: 617437
• UniProt ID: Q96FQ6