Recombinant Human S100A14 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: S100A14-3018H
• Product Overview: S100A14 MS Standard C13 and N15-labeled recombinant protein (NP_065723) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a member of the S100 protein family which contains an EF-hand motif and binds calcium. The gene is located in a cluster of S100 genes on chromosome 1. Levels of the encoded protein have been found to be lower in cancerous tissue and associated with metastasis suggesting a tumor suppressor function (PMID: 19956863, 19351828).
• Molecular Mass: 11.7 kDa
• AA Sequence: MGQCRSANAEDAQEFSDVERAIETLIKNFHQYSVEGGKETLTPSELRDLVTQQLPHLMPSNCGLEEKIANLGSCNDSKLEFRSFWELIGEAAKSVKLERPVRGHTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: S100A14 S100 calcium binding protein A14 [ Homo sapiens (human) ]
• Official Symbol: S100A14
• Synonyms: S100A14; S100 calcium binding protein A14; protein S100-A14; BCMP84; S100A15; S114; S100 calcium-binding protein A14; breast cancer membrane protein 84
• Gene ID: 57402
• mRNA Refseq: NM_020672
• Protein Refseq: NP_065723
• MIM: 607986
• UniProt ID: Q9HCY8