Recombinant Human S100A1 Protein (101 aa), His-tagged

• Cat.No.: S100A1-314S
• Product Overview: Recombinant S100 calcium-binding protein A1 (S100A1) with His tag produced in E. coli is a single chain containing 101 amino acids with molecular mass of 11.5 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques.

Specification

• Description: S100 calcium-binding protein A1 (S100A1) is a small calcium binding protein with EF-hand structures and belongs to the S100 family. S100 proteins include at least 25 members which are located as a cluster on human chromosome 1q21. S100A1 is found in the heart, skeletal muscle, brain, and kidney.S100A1 mainly resides on the sarcoplasmic reticulum, mitochondria and myofilaments. S100A1 may function in stimulation of Ca2+-induced Ca2+ release, inhibition of microtubule assembly, and inhibition of protein kinase C-mediated phosphorylation. Reduced expression of this protein has been implicated in cardiomyopathies.
• Source: E. coli
• Species: Human
• Tag: His
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Molecular Mass: 11.5 kDa, observed by reducing SDS-PAGE.
• Protein length: 101
• AA Sequence: MHHHHHHMGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS
• Endotoxin: < 1 EU/μg, determined by LAL method.
• Purity: > 95% as analyzed by SDS-PAGE and HPLC.
• Storage: Lyophilized recombinant S100 calcium- binding protein A1 (S100A1) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, S100A1 should be stable up to 2 week at 4 centigrade or up to 3 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against 20 mM Tris-HCl, 0.1 mM EDTA, pH7.0.
• Reconstitution: Reconstituted in ddH2O at 200 μg/mL.

Gene Information

• Gene Name: S100A1 S100 calcium binding protein A1 [ Homo sapiens ]
• Official Symbol: S100A1
• Synonyms: S100A1; S100 calcium binding protein A1; S100 calcium binding protein A1, S100A; protein S100-A1; S100 alpha; S-100 protein alpha chain; S-100 protein subunit alpha; S100 calcium-binding protein A1; S100 protein, alpha polypeptide; S100; S100A; S100-alpha
• Gene ID: 6271
• mRNA Refseq: NM_006271
• Protein Refseq: NP_006262
• MIM: 176940
• UniProt ID: P23297