Recombinant Human RTKN2 protein, His-tagged

• Cat.No.: RTKN2-2461H
• Product Overview: Recombinant Human RTKN2 protein(1-163 aa), fused with His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 1-163 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: MEGPSLRGPALRLAGLPTQQDCNIQEKIDLEIRMREGIWKLLSLSTQKDQVLHAVKNLMVCNARLMAYTSELQKLEEQIANQTGRCDVKFESKERTACKGKIAISDIRIPLMWKDSDHFSNKERSRRYAIFCLFKMGANVFDTDVVNVDKTITDICFENVTIL
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: RTKN2 rhotekin 2 [ Homo sapiens ]
• Official Symbol: RTKN2
• Synonyms: RTKN2; rhotekin 2; pleckstrin homology domain containing, family K member 1 , PLEKHK1; rhotekin-2; bA531F24.1; Em:AC024597.2; FLJ39352; PH domain-containing family K member 1; pleckstrin homology domain-containing family K member 1; pleckstrin homology domain containing, family K member 1; PLEKHK1; DKFZp686J10120
• Gene ID: 219790
• mRNA Refseq: NM_145307
• Protein Refseq: NP_660350
• UniProt ID: Q8IZC4