Recombinant Human RTCB Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: RTCB-6278H
• Product Overview: C22orf28 MS Standard C13 and N15-labeled recombinant protein (NP_055121) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: RTCB (RNA 2',3'-Cyclic Phosphate And 5'-OH Ligase) is a Protein Coding gene. Diseases associated with RTCB include Oropharyngeal Anthrax. Among its related pathways are tRNA processing and Gene Expression. Gene Ontology (GO) annotations related to this gene include RNA ligase (ATP) activity.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 55.2 kDa
• AA Sequence: MSRSYNDELQFLEKINKNCWRIKKGFVPNMQVEGVFYVNDALEKLMFEELRNACRGGGVGGFLPAMKQIGNVAALPGIVHRSIGLPDVHSGYGFAIGNMAAFDMNDPEAVVSPGGVGFDINCGVRLLRTNLDESDVQPVKEQLAQAMFDHIPVGVGSKGVIPMNAKDLEEALEMGVDWSLREGYAWAEDKEHCEEYGRMLQADPNKVSARAKKRGLPQLGTLGAGNHYAEIQVVDEIFNEYAAKKMGIDHKGQVCVMIHSGSRGLGHQVATDALVAMEKAMKRDKIIVNDRQLACARIASPEGQDYLKGMAAAGNYAWVNRSSMTFLTRQAFAKVFNTTPDDLDLHVIYDVSHNIAKVEQHVVDGKERTLLVHRKGSTRAFPPHHPLIAVDYQLTGQPVLIGGTMGTCSYVLTGTEQGMTETFGTTCHGAGRALSRAKSRRNLDFQDVLDKLADMGIAIRVASPKLVMEEAPESYKNVTDVVNTCHDAGISKKAIKLRPIAVIKGTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: RTCB RNA 2',3'-cyclic phosphate and 5'-OH ligase [ Homo sapiens (human) ]
• Official Symbol: RTCB
• Synonyms: RTCB; RNA 2',3'-cyclic phosphate and 5'-OH ligase; FAAP; HSPC117; C22orf28; DJ149A16.6; RNA-splicing ligase RtcB homolog; 3'-phosphate/5'-hydroxy nucleic acid ligase; ankyrin repeat domain 54; focal adhesion-associated protein; tRNA-splicing ligase RtcB homolog; EC 6.5.1.8
• Gene ID: 51493
• mRNA Refseq: NM_014306
• Protein Refseq: NP_055121
• MIM: 613901
• UniProt ID: Q9Y3I0