Recombinant Human RSPH9 Protein, GST-Tagged

• Cat.No.: RSPH9-0117H
• Product Overview: Human C6orf206 full-length ORF (NP_689945.2, 1 a.a. - 276 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a protein thought to be a component of the radial spoke head in motile cilia and flagella. Mutations in this gene are associated with primary ciliary dyskinesia 12. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Jul 2010]
• Molecular Mass: 57.7 kDa
• AA Sequence: MDADSLLLSLELASGSGQGLSPDRRASLLTSLMLVKRDYRYDRVLFWGRILGLVADYYIAQGLSEDQLAPRKTLYSLNCTEWSLLPPATEEMVAQSSVVKGRFMGDPSYEYEHTELQKVNEGEKVFEEEIVVQIKEETRLVSVIDQIDKAVAIIPRGALFKTPFGPTHVNRTFEGLSLSEAKKLSSYFHFREPVELKNKTLLEKADLDPSLDFMDSLEHDIPKGSWSIQMERGNALVVLRSLLWPGLTFYHAPRTKNYGYVYVGTGEKNMDLPFML
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: RSPH9 radial spoke head 9 homolog (Chlamydomonas) [ Homo sapiens ]
• Official Symbol: RSPH9
• Synonyms: RSPH9; radial spoke head 9 homolog (Chlamydomonas); C6orf206, chromosome 6 open reading frame 206, mitochondrial ribosomal protein S18A like 1, MRPS18AL1; radial spoke head protein 9 homolog; CILD12; FLJ30845; C6orf206; MRPS18AL1
• Gene ID: 221421
• mRNA Refseq: NM_001193341
• Protein Refseq: NP_001180270
• MIM: 612648
• UniProt ID: Q9H1X1