Recombinant Human RSF1 Protein, GST-tagged

• Cat.No.: RSF1-4610H
• Product Overview: Human HBXAP partial ORF ( NP_057662.3, 1343 a.a. - 1441 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: HBXAP is involved in transcription repression, transcription coactivation when associated with hepatitis B virus X protein (HBX), and chromatin remodeling and spacing when associated with SNF2H (MIM 603375).[supplied by OMIM
• Molecular Mass: 36.63 kDa
• AA Sequence: IESDEEEDFENVGKVGSPLDYSLVDLPSTNGQSPGKAIENLIGKPTEKSQTPKDNSTASASLASNGTSGGQEAGAPEEEEDELLRVTDLVDYVCNSEQL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: RSF1 remodeling and spacing factor 1 [ Homo sapiens ]
• Official Symbol: RSF1
• Synonyms: RSF1; remodeling and spacing factor 1; HBXAP, hepatitis B virus x associated protein; p325; RSF 1; XAP8; HBV pX associated protein-8; HBV pX-associated protein 8; hepatitis B virus x associated protein; hepatitis B virus x-associated protein; p325 subunit of RSF chromatin-remodeling complex; HBXAP; RSF-1
• Gene ID: 51773
• mRNA Refseq: NM_016578
• Protein Refseq: NP_057662
• MIM: 608522
• UniProt ID: Q96T23