Recombinant Human RRP36 Protein, GST-Tagged

• Cat.No.: RRP36-0109H
• Product Overview: Human C6orf153 full-length ORF (NP_149103.1, 1 a.a. - 259 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: RRP36 functions at an early stage in the processing of 35S preribosomal RNA into the mature 18S species (Gerus et al., 2010 [PubMed 20038530]).[supplied by OMIM, Jul 2010]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 56.2 kDa
• AA Sequence: MPGANYRAGAGAGAGARRPRGARDREEDGGGLEPAAVARDLLRGTSNMSFEELLELQSQVGTKTYKQLVAGNSPKKQASRPPIQNACVADKHRPLEMSAKIRVPFLRQVVPISKKVARDPRFDDLSGEYNPEVFDKTYQFLNDIRAKEKELVKKQLKKHLSGEEHEKLQQLLQRMEQQEMAQQERKQQQELHLALKQERRAQAQQGHRPYFLKKSEQRQLALAEKFKELKRSKKLENFLSRKRRRNAGKDRRHLPLSKE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: RRP36 ribosomal RNA processing 36 homolog (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: RRP36
• Synonyms: C6orf153; dJ20C7.4
• Gene ID: 88745
• mRNA Refseq: NM_033112
• Protein Refseq: NP_149103
• MIM: 613475
• UniProt ID: Q96EU6