Recombinant Human RRM1

• Cat.No.: RRM1-29473TH
• Product Overview: Recombinant fragment of Human RRM1 (amino acids 644-753) with N terminal proprietary tag; Predicted MWt 37.73 kDa including the tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 110 amino acids
• Description: This gene encodes one of two non-identical subunits that constitute ribonucleoside-diphosphate reductase, an enzyme essential for the production of deoxyribonucleotides prior to DNA synthesis in S phase of dividing cells. It is one of several genes located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocrotical carcinoma, and lung, ovarian, and breast cancer. This gene may play a role in malignancies and disease that involve this region.
• Molecular Weight: 37.730kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: DLTERGLWHEEMKNQIIACNGSIQSIPEIPDDLKQLYKTV WEISQKTVLKMAAERGAFIDQSQSLNIHIAEPNYGKLTSM HFYGWKQGLKTGMYYLRTRPAANPIQFTLN
• Sequence Similarities: Belongs to the ribonucleoside diphosphate reductase large chain family.Contains 1 ATP-cone domain.

Gene Information

• Gene Name: RRM1 ribonucleotide reductase M1 [ Homo sapiens ]
• Official Symbol: RRM1
• Synonyms: RRM1; ribonucleotide reductase M1; ribonucleotide reductase M1 polypeptide; ribonucleoside-diphosphate reductase large subunit
• Gene ID: 6240
• mRNA Refseq: NM_001033
• Protein Refseq: NP_001024
• MIM: 180410
• Uniprot ID: P23921
• Chromosome Location: 11p15.5
• Pathway: E2F transcription factor network, organism-specific biosystem; Fluoropyrimidine Activity, organism-specific biosystem; Glutathione metabolism, organism-specific biosystem; Glutathione metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem
• Function: ATP binding; oxidoreductase activity; purine nucleotide binding; ribonucleoside-diphosphate reductase activity; ribonucleoside-diphosphate reductase activity