Recombinant Full Length Human RRAD Protein, C-Flag-tagged

• Cat.No.: RRAD-1676HFL
• Product Overview: Recombinant Full Length Human RRAD Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Description: Predicted to enable GTP binding activity and calcium channel regulator activity. Predicted to be involved in small GTPase mediated signal transduction. Predicted to be located in cytosol. Predicted to be active in plasma membrane. Implicated in type 2 diabetes mellitus. Biomarker of congestive heart failure.
• Source: Mammalian cells
• Species: Human
• Tag: Flag
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 33.1 kDa
• AA Sequence: MTLNGGGSGAGGSRGGGQERERRRGSTPWGPAPPLHRRSMPVDERDLQAALTPGALTAAAAGTGTQGPRL DWPEDSEDSLSSGGSDSDESVYKVLLLGAPGVGKSALARIFGGVEDGPEAEAAGHTYDRSIVVDGEEASL MVYDIWEQDGGRWLPGHCMAMGDAYVIVYSVTDKGSFEKASELRVQLRRARQTDDVPIILVGNKSDLVRS REVSVDEGRACAVVFDCKFIETSAALHHNVQALFEGVVRQIRLRRDSKEANARRQAGTRRRESLGKKAKR
  FLGRIVARNSRKMAFRAKSKSCHDLSVLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Full Length: Full L.

Gene Information

• Gene Name: RRAD RRAD, Ras related glycolysis inhibitor and calcium channel regulator [ Homo sapiens (human) ]
• Official Symbol: RRAD
• Synonyms: RAD; RAD1; REM3
• Gene ID: 6236
• mRNA Refseq: NM_004165.3
• Protein Refseq: NP_004156.1
• MIM: 179503
• UniProt ID: P55042