Recombinant Human RPS3 protein, His-SUMO-tagged
Cat.No. : | RPS3-3450H |
Product Overview : | Recombinant Human RPS3 protein(P23396)(2-243aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 2-243aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 42.6 kDa |
AA Sequence : | AVQISKKRKFVADGIFKAELNEFLTRELAEDGYSGVEVRVTPTRTEIIILATRTQNVLGEKGRRIRELTAVVQKRFGFPEGSVELYAEKVATRGLCAIAQAESLRYKLLGGLAVRRACYGVLRFIMESGAKGCEVVVSGKLRGQRAKSMKFVDGLMIHSGDPVNYYVDTAVRHVLLRQGVLGIKVKIMLPWDPTGKIGPKKPLPDHVSIVEPKDEILPTTPISEQKGGKPEPPAMPQPVPTA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | RPS3 ribosomal protein S3 [ Homo sapiens ] |
Official Symbol | RPS3 |
Synonyms | RPS3; ribosomal protein S3; 40S ribosomal protein S3; FLJ26283; FLJ27450; IMR 90 ribosomal protein S3; MGC87870; S3; IMR-90 ribosomal protein S3; |
Gene ID | 6188 |
mRNA Refseq | NM_001005 |
Protein Refseq | NP_000996 |
MIM | 600454 |
UniProt ID | P23396 |
◆ Recombinant Proteins | ||
RPS3-4827R | Recombinant Rat RPS3 Protein, His (Fc)-Avi-tagged | +Inquiry |
RPS3-2421H | Recombinant Human Ribosomal Protein S3, His-tagged | +Inquiry |
RPS3-29970TH | Recombinant Human RPS3 | +Inquiry |
RPS3-480H | Recombinant Human RPS3, GST-tagged | +Inquiry |
RPS3-1106H | Recombinant Human RPS3 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RPS3-563HCL | Recombinant Human RPS3 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RPS3 Products
Required fields are marked with *
My Review for All RPS3 Products
Required fields are marked with *
0
Inquiry Basket