Recombinant Human RPS3 protein, His-SUMO-tagged

Cat.No. : RPS3-3450H
Product Overview : Recombinant Human RPS3 protein(P23396)(2-243aa), fused to N-terminal His-SUMO tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 2-243aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 42.6 kDa
AA Sequence : AVQISKKRKFVADGIFKAELNEFLTRELAEDGYSGVEVRVTPTRTEIIILATRTQNVLGEKGRRIRELTAVVQKRFGFPEGSVELYAEKVATRGLCAIAQAESLRYKLLGGLAVRRACYGVLRFIMESGAKGCEVVVSGKLRGQRAKSMKFVDGLMIHSGDPVNYYVDTAVRHVLLRQGVLGIKVKIMLPWDPTGKIGPKKPLPDHVSIVEPKDEILPTTPISEQKGGKPEPPAMPQPVPTA
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name RPS3 ribosomal protein S3 [ Homo sapiens ]
Official Symbol RPS3
Synonyms RPS3; ribosomal protein S3; 40S ribosomal protein S3; FLJ26283; FLJ27450; IMR 90 ribosomal protein S3; MGC87870; S3; IMR-90 ribosomal protein S3;
Gene ID 6188
mRNA Refseq NM_001005
Protein Refseq NP_000996
MIM 600454
UniProt ID P23396

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All RPS3 Products

Required fields are marked with *

My Review for All RPS3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon